General Information

  • ID:  hor001891
  • Uniprot ID:  P0DJ95
  • Protein name:  PACAP-related peptide
  • Gene name:  Adcyap1
  • Organism:  Heloderma suspectum (Gila monster)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0010628 positive regulation of gene expression; GO:0030073 insulin secretion; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IFNKAYRKVLGQLSARKYLHSLM
  • Length:  23
  • Propeptide:  IFNKAYRKVLGQLSARKYLHSLMHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes neuron projection development
  • Mechanism:  Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cell
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DJ95-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001891_AF2.pdbhor001891_ESM.pdb

Physical Information

Mass: 312990 Formula: C126H206N36O30S
Absent amino acids: CDEPTW Common amino acids: L
pI: 11.15 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 9
Hydrophobicity: -14.35 Boman Index: -3188
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 106.09
Instability Index: 881.74 Extinction Coefficient cystines: 2980
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  NA
  • Title:  NA